Integrin-β1/CD29 Rabbit pAb (APR24727N)

CAT:
882-APR24727N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Integrin-β1/CD29 Rabbit pAb (APR24727N) - image 1

Integrin-β1/CD29 Rabbit pAb (APR24727N)

  • Background:

    Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene.
  • Synonyms:

    CD29; FNRB; GPIIA; MDF2; MSK12; VLA-BETA; VLAB; Integrin beta 1; ITGB1; Integrin β1
  • Gene ID:

    3688
  • UniProt:

    P05556
  • Cellular Locus:

    Cell junction, Cell membrane, Cell projection, Cleavage furrow, Melanosome, Recycling endosome, Single-pass type I membrane protein, invadopodium membrane, lamellipodium, ruffle membrane, ruffle, sarcolemma
  • Applications:

    WB (Homo sapiens, Capra hircus)
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 87kDa/88kDa/91kDa Observed MW: 135KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Integrin-β1/CD29 Rabbit pAb (APR24727N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3688
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P05556
  • AA Sequence:

    EASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCW