HER2 / ErbB2 Rabbit pAb (APR24596N)
CAT:
882-APR24596N-01
Size:
50 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


HER2 / ErbB2 Rabbit pAb (APR24596N)
Background:
This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.Synonyms:
ERBB2; CD340; HER-2; HER-2/neu; HER2; MLN 19; NEU; NGL; TKR1; erb-b2 receptor tyrosine kinase 2; HER2/ErbB2; ErbB2; MLN19Gene ID:
2064UniProt:
P04626Cellular Locus:
Cell membrane, Cytoplasm, Nucleus, Nucleus, Single-pass type I membrane protein, perinuclear regionApplications:
WB (Mus musculus, Homo sapiens)Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:100Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 62kDa/70kDa/97kDa/134kDa/136kDa/137kDa Observed MW: 185KDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HER2 / ErbB2 Rabbit pAb (APR24596N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2064Uniprot URL:
https://www.uniprot.org/uniprot/P04626AA Sequence:
ARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV