CD151 Rabbit pAb (APR24472N)

CAT: 0882-APR24472N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR24472N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD151 Rabbit pAb (APR24472N) .

Synonyms

CD151; GP27; MER2; PETA-3; RAPH; SFA1; TSPAN24

Gene ID

977

UniProt

P48509

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa Observed MW: 28KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=977

Uniprot URL

https://www.uniprot.org/uniprot/P48509

AA Sequence

AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

UniProtKB · P48509

CD151 antigen

CD151_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P48509
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: CD151
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: —
Secondary accessions: A8KAK8, E9PI15, Q14826, Q86U54, Q96TE3

Protein keywords

Molecular function

Blood group antigen

Cellular component

Cell membraneMembrane

Disease

DeafnessEpidermolysis bullosa

PTM

GlycoproteinLipoproteinPalmitateUbl conjugation

Biological process

Host-virus interaction

Technical term

Proteomics identificationReference proteome

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
APR24492N-01	SH3KBP1 Rabbit pAb (APR24492N)
APR24473N-01	CLN3 Rabbit pAb (APR24473N)
APR24471N-01	BUB1 Rabbit pAb (APR24471N)
APR24470N-01	GDF5 Rabbit pAb (APR24470N)
APR24422N-01	ACADM Rabbit pAb (APR24422N)
APR24412N-01	DKC1 Rabbit pAb (APR24412N)
APR24272N-01	PIN4 Rabbit pAb (APR24272N)
APR28472N-01	HVCN1 Rabbit pAb (APR28472N)
APR24482N-01	S100A7 Rabbit pAb (APR24482N)
APR24475N-01	GPX4 Rabbit pAb (APR24475N)

Alternative Products

Catalog	Name
E47R22290	CD151 Rabbit pAb
GTR17765366-01	CD151 Rabbit Polyclonal Antibody
DL96736A-01	Rabbit anti-CD151 Antibody
E2620154	CD151 (Center) Rabbit pAb
abx326895-01	CD151 Antigen (CD151) Antibody
377279	CD151