CADM1 Rabbit pAb (APR24436N)

CAT:
882-APR24436N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CADM1 Rabbit pAb (APR24436N) - image 1

CADM1 Rabbit pAb (APR24436N)

  • Synonyms:

    CADM1; BL2; IGSF4; IGSF4A; NECL2; Necl-2; RA175; ST17; SYNCAM; TSLC1; sTSLC-1; sgIGSF; synCAM1
  • Gene ID:

    23705
  • UniProt:

    Q9BY67
  • Cellular Locus:

    Cell junction, Cell membrane, Single-pass type I membrane protein, synapse
  • Applications:

    WB (Mus musculus)
  • Dilution:

    WB 1:500 - 1:2000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 36kDa/45kDa/48kDa/49kDa/51kDa Observed MW: 50KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CADM1 Rabbit pAb (APR24436N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23705
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9BY67
  • AA Sequence:

    QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGSIRAV