EIF6 Rabbit pAb (APR24277N)

CAT: 0882-APR24277N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR24277N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple non-protein coding transcript variants and variants encoding two different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF6 Rabbit pAb (APR24277N) .

Synonyms

EIF6; CAB; EIF3A; ITGB4BP; b (2) gcn; eIF-6; p27 (BBP) ; p27BBP

Gene ID

3692

UniProt

P56537

Cellular Locus

Cytoplasm, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa/26kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3692

Uniprot URL

https://www.uniprot.org/uniprot/P56537

AA Sequence

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

UniProtKB · P56537

Eukaryotic translation initiation factor 6

IF6_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P56537
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: EIF6
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: eIF-6
EC number: —
Processing: —
Secondary accessions: B7ZBG9, Q6IBN8, Q96TD5

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Cellular component

CytoplasmNucleus

Molecular function

Initiation factor

PTM

PhosphoproteinUbl conjugation

Biological process

Protein biosynthesisRibosome biogenesis

Related Products

Catalog	Name
APR20277N-01	CEP27 Rabbit pAb (APR20277N)
APR26277N-01	CLCN2 Rabbit pAb (APR26277N)
APR24977N-01	BDKRB2 Rabbit pAb (APR24977N)
APR24257N-01	AJUBA Rabbit pAb (APR24257N)
APR24077N-01	HGS Rabbit pAb (APR24077N)
APR21277N-01	PHC2 Rabbit pAb (APR21277N)
APR24877N-01	SDHA Rabbit pAb (APR24877N)
APR24275N-01	OSR2 Rabbit pAb (APR24275N)
APR24227N-01	TEX101 Rabbit pAb (APR24227N)
APR24777N-01	EEF1A2 Rabbit pAb (APR24777N)

Alternative Products

Catalog	Name
E45R24277N-100	EIF6 Rabbit pAb
GTR18217897-01	Rabbit eIF6 Antibody
MBS225596-01	Rabbit Anti EIF6
YLD2773-01	Rabbit anti-EIF6 Antibody
GTR17875788	EIF6 Rabbit Polyclonal Antibody
GTR18354133	EIF6 Rabbit Polyclonal Antibody (HRP)
MBS8109466-01	Anti-EIF6 Antibody, Rabbit Polyclonal
UB-GEN-10326	EIF6 (Phospho-Ser235) rabbit pAb
522608-01	EIF6