ORM1 Rabbit pAb (APR24140N)

CAT:
882-APR24140N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ORM1 Rabbit pAb (APR24140N) - image 1

ORM1 Rabbit pAb (APR24140N)

  • Background :

    This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression.
  • Synonyms :

    ORM1; AGP-A; AGP1; HEL-S-153w; ORM
  • Gene ID :

    5004
  • UniProt :

    P02763
  • Cellular Locus :

    Secreted
  • Applications :

    WB (Human cells)
  • Dilution :

    WB 1:500 - 1:2000
  • Form :

    Liquid
  • Buffer :

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight :

    Calculated MW: 23kDa Observed MW: 40kDa
  • Storage Conditions :

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview :

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ORM1 Rabbit pAb (APR24140N) .
  • Gene ID URL :

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5004
  • Uniprot URL :

    https://www.uniprot.org/uniprot/P02763
  • AA Sequence :

    TLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide