MT-ND5 Rabbit pAb (APR24128N)

CAT:
882-APR24128N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MT-ND5 Rabbit pAb (APR24128N) - image 1

MT-ND5 Rabbit pAb (APR24128N)

  • Background:

    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I.
  • Synonyms:

    MTND5; MT-ND5
  • Gene ID:

    4540
  • UniProt:

    P03915
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 67kDa Observed MW: 70KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MT-ND5 Rabbit pAb (APR24128N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4540
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P03915
  • AA Sequence:

    LTNKLKMKSPLCTFYFSNMLGFYPTITHRTIPYLGLLTSQNLPLLLLDLTWLEKLLPKTISQHQISTSIITSTQKGMIKLYFLSFFFPLILTLLLIT