OSTC Rabbit pAb (APR23565N)

CAT:
882-APR23565N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
OSTC Rabbit pAb (APR23565N) - image 1

OSTC Rabbit pAb (APR23565N)

  • Background:

    Subunit of the oligosaccharyl transferase (OST complex that catalyzes the initial transfer of a defined glycan (Glc (3Man (9GlcNAc (2 in eukaryotes from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER. All subunits are required for a maximal enzyme activity. May be involved in N-glycosylation of APP (amyloid-beta precursor protein. Can modulate gamma-secretase cleavage of APP by enhancing endoprotelysis of PSEN1.
  • Synonyms:

    OSTC; DC2
  • Gene ID:

    58505
  • UniProt:

    Q9NRP0
  • Dilution:

    WB 1:500 - 1:2000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Observed MW: Refer to figures
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OSTC Rabbit pAb (APR23565N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=58505
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9NRP0
  • AA Sequence:

    YDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG