THY1 Rabbit pAb (APR23461N)

CAT: 0882-APR23461N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR23461N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality THY1 Rabbit pAb (APR23461N) .

Synonyms

THY1; CD90; CDw90

Gene ID

7070

UniProt

P04216

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7070

Uniprot URL

https://www.uniprot.org/uniprot/P04216

AA Sequence

DQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFT

UniProtKB · P04216

Thy-1 membrane glycoprotein

THY1_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P04216
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: THY1
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: Q16008, Q9NSP1

Protein keywords

Cellular component

Cell membraneMembrane

PTM

Disulfide bondGlycoproteinGPI-anchorLipoproteinPhosphoproteinPyrrolidone carboxylic acid

Domain

Immunoglobulin domainSignal

Technical term

Proteomics identificationReference proteome

Related Products

Catalog	Name
APR24646N-01	CD90/Thy1 Rabbit pAb (APR24646N)
APR25461N-01	ATP6V0D1 Rabbit pAb (APR25461N)
APR23561N-01	SLC17A7 Rabbit pAb (APR23561N)
APR23481N-01	CEACAM1 Rabbit pAb (APR23481N)
APR23467N-01	UCP3 Rabbit pAb (APR23467N)
APR23451N-01	KIR2DL1 Rabbit pAb (APR23451N)
APR23416N-01	DPF3 Rabbit pAb (APR23416N)
APR23411N-01	CDK2 Rabbit pAb (APR23411N)
APR23161N-01	KIF17 Rabbit pAb (APR23161N)
APR22461N-01	WDR18 Rabbit pAb (APR22461N)

Alternative Products

Catalog	Name
E45R23461N-100	THY1 Rabbit pAb
GTR18154891-01	THY1 Rabbit Polyclonal Antibody
A02729-50	THY1 Antibody, mAb, Rabbit
A12623-01	CD90/Thy1 Rabbit mAb
A16986	CD90/Thy1 Rabbit pAb
AB101898	CD90 / Thy1 Rabbit mAb
E49Y5335	THY1 Rabbit Monoclonal Antibody
405138-01	THY1