TSG101/VPS23 Rabbit pAb (APR23431N)
CAT:
882-APR23431N-01
Size:
50 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


TSG101/VPS23 Rabbit pAb (APR23431N)
Background:
The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.Synonyms:
TSG10; VPS23; TSG101 / VPS23; TSG101Gene ID:
7251UniProt:
Q99816Cellular Locus:
Cytoplasm, Late endosome membrane, Membrane, Nucleus, Peripheral membrane proteinApplications:
WB (HEK293T, Homo sapiens, Mus musculus, Rattus norvegicus, Cynoglossus semilaevis, Gallus gallus)Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:100 IP 1:50 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 31kDa/43kDa Observed MW: 44kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TSG101/VPS23 Rabbit pAb (APR23431N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7251Uniprot URL:
https://www.uniprot.org/uniprot/Q99816AA Sequence:
SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY