SRSF7 Rabbit pAb (APR23327N)
CAT:
882-APR23327N-01
Size:
50 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


SRSF7 Rabbit pAb (APR23327N)
Background:
The protein encoded by this gene is a member of the serine/arginine (SR) -rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants encoding different isoforms have been found for this gene.Synonyms:
SRSF7; 9G8; AAG3; SFRS7Gene ID:
6432UniProt:
Q16629Cellular Locus:
Cytoplasm, NucleusDilution:
WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:50 - 1:100Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 15kDa/26kDa/27kDa Observed MW: 35KDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SRSF7 Rabbit pAb (APR23318N8) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6432Uniprot URL:
https://www.uniprot.org/uniprot/Q16629AA Sequence:
AEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH