[KO Validated] PDK1/PDPK1 Rabbit pAb (APR23247N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] PDK1/PDPK1 Rabbit pAb (APR23247N) - image 1](/gentaur-product-1.webp)
![[KO Validated] PDK1/PDPK1 Rabbit pAb (APR23247N) - image 1](/gentaur-product-1.webp)
[KO Validated] PDK1/PDPK1 Rabbit pAb (APR23247N)
Background:
PDPK1 (3-phosphoinositide dependent protein kinase 1) is a protein-coding gene. GO annotations related to this gene include protein serine/threonine kinase activity and insulin receptor binding.Synonyms:
PDPK1; PDK1; PDPK2; PDPK2P; PRO0461Gene ID:
5170UniProt:
O15530Cellular Locus:
Cell junction, Cell membrane, Cytoplasm, Nucleus, Peripheral membrane protein, focal adhesionApplications:
WB (Homo sapiens, Mus musculus) IP (Homo sapiens, Mus musculus) IHC (Homo sapiens, Mus musculus)Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 48kDa/50kDa/58kDa/60kDa/63kDa Observed MW: 58-68KDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] PDK1/PDPK1 Rabbit pAb (APR23247N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5170Uniprot URL:
https://www.uniprot.org/uniprot/O15530AA Sequence:
AGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
