IGFBPL1 Rabbit pAb (APR23235N)

CAT:
882-APR23235N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IGFBPL1 Rabbit pAb (APR23235N) - image 1

IGFBPL1 Rabbit pAb (APR23235N)

  • Background:

    IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors (By similarity. May be a putative tumor suppressor protein.
  • Synonyms:

    IGFBPL1; IGFBP-RP4; IGFBPRP4; bA113O24.1
  • Gene ID:

    347252
  • UniProt:

    Q8WX77
  • Dilution:

    WB 1:500 - 1:2000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 29kDa Observed MW: 35kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IGFBPL1 Rabbit pAb (APR23235N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=347252
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q8WX77
  • AA Sequence:

    PCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVG