NOMO2 Rabbit pAb (APR23217N)

CAT: 0882-APR23217N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR23217N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE) . Two transcripts encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NOMO2 Rabbit pAb (APR23217N) .

Synonyms

NOMO2; Nomo; PM5

Gene ID

283820

UniProt

Q5JPE7

Cellular Locus

Endoplasmic reticulum membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 122kDa/134kDa/139kDa Observed MW: 139kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=283820

Uniprot URL

https://www.uniprot.org/uniprot/Q5JPE7

AA Sequence

YALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVGALGQAASDNSGPEDAKRQAKKQKTRRT

UniProtKB · Q5JPE7

BOS complex subunit NOMO2

NOMO2_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: Q5JPE7
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: NOMO2
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: Q4G177

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Cellular component

Endoplasmic reticulumMembrane

PTM

Glycoprotein

Domain

SignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
APR23317N-01	DNMT1 Rabbit pAb (APR23317N)
APR23287N-01	CCNB1IP1 Rabbit pAb (APR23287N)
APR23267N-01	CORO2B Rabbit pAb (APR23267N)
APR23215N-01	NPB Rabbit pAb (APR23215N)
APR23214N-01	LNX2 Rabbit pAb (APR23214N)
APR23212N-01	UGT1A9 Rabbit pAb (APR23212N)
APR23210N-01	RNF152 Rabbit pAb (APR23210N)
APR22217N-01	C1R Rabbit pAb (APR22217N)
APR21217N-01	SP1 Rabbit pAb (APR21217N)
APR23227N-01	CARD16 Rabbit pAb (APR23227N)

Alternative Products

Catalog	Name
MBS8550416-01	NOMO2 Rabbit pAb
MBS9513118-01	NOMO2 Rabbit Polyclonal Antibody
NBP2-94729-0.1mL	Rabbit Polyclonal NOMO2 Antibody
GB114494	Anti-NOMO2 Rabbit pAb
WP5740-01	U-Blot® NOMO2 rabbit pAb
PA10322-01	Rabbit Anti-Human NOMO2 pAb
MBS9356603	Rabbit NODAL Modulator 2 (NOMO2) ELISA Kit
70R-18920	NOMO2 antibody
DF13191-BP	NOMO2 Peptide