[KO Validated] RhoA Rabbit pAb (APR22208N)

• Background:

  This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

• Synonyms:

  ARH12; ARHA; RHO12; RHOH12; Rho; RHOA; RhoA

• Gene ID:

  387

• UniProt:

  P61586

• Cellular Locus:

  Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, cell cortex, cytoskeleton, lamellipodium

• Applications:

  WB (Rattus norvegicus)

• Dilution:

  WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 21kDa Observed MW: 21kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] RhoA Rabbit pAb (APR22208N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=387

• Uniprot URL:

  https://www.uniprot.org/uniprot/P61586

• AA Sequence:

  MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL