MYH2 Rabbit pAb (APR21848N)

• Background:

  Myosins are actin-based motor proteins that function in the generation of mechanical force in eukaryotic cells. Muscle myosins are heterohexamers composed of 2 myosin heavy chains and 2 pairs of nonidentical myosin light chains. This gene encodes a member of the class II or conventional myosin heavy chains, and functions in skeletal muscle contraction. This gene is found in a cluster of myosin heavy chain genes on chromosome 17. A mutation in this gene results in inclusion body myopathy-3. Multiple alternatively spliced variants, encoding the same protein, have been identified.

• Synonyms:

  MYH2; IBM3; MYH2A; MYHSA2; MYHas8; MYPOP; MyHC-2A; MyHC-IIa; myosin-2

• Gene ID:

  4620

• UniProt:

  Q9UKX2

• Cellular Locus:

  Cytoplasm, myofibril

• Applications:

  WB (Sus scrofa)

• Dilution:

  WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 79kDa/223kDa Observed MW: 250KDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MYH2 Rabbit pAb (APR21848N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4620

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9UKX2

• AA Sequence:

  SFKNKLYDQHLGKSANFQKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKNKDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSF