UNC93B1 Rabbit pAb (APR21805N)

• Background:

  This gene encodes a protein that is involved in innate and adaptive immune response by regulating toll-like receptor signaling. The encoded protein traffics nucleotide sensing toll-like receptors to the endolysosome from the endoplasmic reticulum. Deficiency of the encoded protein has been associated with herpes simplex encephalitis.

• Synonyms:

  UNC93B1; IIAE1; UNC93; UNC93B; Unc-93B1

• Gene ID:

  81622

• UniProt:

  Q9H1C4

• Cellular Locus:

  Cytoplasmic vesicle, Endoplasmic reticulum membrane, Endosome, Lysosome, Multi-pass membrane protein, phagosome

• Dilution:

  WB 1:500 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 66kDa Observed MW: 70kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UNC93B1 Rabbit pAb (APR21805N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81622

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9H1C4

• AA Sequence:

  KTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDES