PP2A-B56δ/PR61δ/PPP2R5E Rabbit pAb (APR21632N)

CAT:
882-APR21632N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PP2A-B56δ/PR61δ/PPP2R5E Rabbit pAb (APR21632N) - image 1

PP2A-B56δ/PR61δ/PPP2R5E Rabbit pAb (APR21632N)

  • Background:

    The protein encoded by this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an epsilon isoform of the regulatory subunit B56 subfamily. Multiple transcript variants encoding several different isoforms have been found for this gene.
  • Synonyms:

    PPP2R5E; B56E; B56epsilon
  • Gene ID:

    5529
  • UniProt:

    Q16537
  • Cellular Locus:

    Cytoplasm
  • Dilution:

    WB 1:500 - 1:2000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 46kDa/54kDa Observed MW: 54kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PP2A-B56δ/PR61δ/PPP2R5E Rabbit pAb (APR21627N4) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5529
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q16537
  • AA Sequence:

    HWNPAIVALVYNVLKAFMEMNSTMFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT