ORMDL3 Rabbit pAb (APR21505N)

• Background:

  Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca (+2 signaling.

• Synonyms:

  ORMDL3

• Gene ID:

  94103

• UniProt:

  Q8N138

• Cellular Locus:

  Endoplasmic reticulum membrane, Multi-pass membrane protein

• Dilution:

  WB 1:500 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 15kDa/17kDa Observed MW: 17kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ORMDL3 Rabbit pAb (APR21505N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=94103

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q8N138

• AA Sequence:

  MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRK