GluR4/GluA4/GRIA4 Rabbit pAb (APR21473N)

CAT:
882-APR21473N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GluR4/GluA4/GRIA4 Rabbit pAb (APR21473N) - image 1

GluR4/GluA4/GRIA4 Rabbit pAb (APR21473N)

  • Background:

    Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate) -sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G) . Alternative splicing of this gene results in transcript variants encoding different isoforms, which may vary in their signal transduction properties. Some haplotypes of this gene show a positive association with schizophrenia.
  • Synonyms:

    GRIA4; GLUR4; GLUR4C; GLURD; GluA4
  • Gene ID:

    2893
  • UniProt:

    P48058
  • Cellular Locus:

    Cell junction, Cell membrane, Cell projection, Multi-pass membrane protein, dendrite, postsynaptic cell membrane, synapse
  • Applications:

    WB (mouse brain, Mus musculus)
  • Dilution:

    WB 1:1000 - 1:4000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 49kDa/100kDa Observed MW: 101kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GluR4/GluA4/GRIA4 Rabbit pAb (APR21473N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2893
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P48058
  • AA Sequence:

    HGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMPLMKNPILRN