ZDHHC15 Rabbit pAb (APR21005N)

CAT:
882-APR21005N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ZDHHC15 Rabbit pAb (APR21005N) - image 1

ZDHHC15 Rabbit pAb (APR21005N)

  • Background:

    The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91) . Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Synonyms:

    ZDHHC15; DHHC15; MRX91
  • Gene ID:

    158866
  • UniProt:

    Q96MV8
  • Cellular Locus:

    Membrane, Multi-pass membrane protein
  • Dilution:

    WB 1:500 - 1:2000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 17kDa/38kDa/39kDa Observed MW: 42kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZDHHC15 Rabbit pAb (APR21005N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=158866
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q96MV8
  • AA Sequence:

    VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET