[KO Validated] EZH2/KMT6 Rabbit pAb (APR20428N)
CAT:
882-APR20428N-01
Size:
50 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] EZH2/KMT6 Rabbit pAb (APR20428N) - image 1](/gentaur-product-1.webp)
![[KO Validated] EZH2/KMT6 Rabbit pAb (APR20428N) - image 1](/gentaur-product-1.webp)
[KO Validated] EZH2/KMT6 Rabbit pAb (APR20428N)
Background:
This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.Synonyms:
ENX-1; ENX1; EZH1; EZH2b; KMT6; KMT6A; WVS; WVS2; EZH2; KMT6 / EZH2Gene ID:
2146UniProt:
Q15910Cellular Locus:
NucleusApplications:
IP (Homo sapiens)Dilution:
WB 1:500 - 1:2000 IP 1:50 - 1:100Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 79kDa/81kDa/84kDa/85kDa/86kDa Observed MW: 105kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] EZH2/KMT6 Rabbit pAb (APR20428N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2146Uniprot URL:
https://www.uniprot.org/uniprot/Q15910AA Sequence:
LERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELI