EIF4G2 Rabbit pAb (APR20193N)

CAT: 0882-APR20193N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR20193N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF4G2 Rabbit pAb (APR20193N) .

Synonyms

EIF4G2; AAG1; DAP5; NAT1; P97

Gene ID

1982

UniProt

P78344

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 98kDa/102kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1982

Uniprot URL

https://www.uniprot.org/uniprot/P78344

AA Sequence

IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLR

UniProtKB · P78344

Eukaryotic translation initiation factor 4 gamma 2

IF4G2_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P78344
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: EIF4G2
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: eIF-4-gamma 2, eIF-4G 2, eIF4G 2
EC number: —
Processing: —
Secondary accessions: O60877, P78404, Q0VH00, Q0VH01, Q2NKW9, Q49A79, Q53EU1, Q58EZ2, Q8NI71, Q96C16

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

PTM

AcetylationIsopeptide bondMethylationPhosphoproteinUbl conjugation

Coding sequence diversity

Alternative splicing

Molecular function

Initiation factorRepressor

Biological process

Protein biosynthesisTranslation regulation

Related Products

Catalog	Name
APR25005N-01	EIF4G2 Rabbit pAb (APR25005N)
APR29425N-01	[KO Validated] EIF4G2 Rabbit pAb (APR29425N)
APR29974N-01	EIF4A1/EIF4A2/EIF4A3 Rabbit pAb (APR29974N)
APR20103N-01	MCM5 Rabbit pAb (APR20103N)
APR27193N-01	MCM10 Rabbit pAb (APR27193N)
APR25193N-01	PAK1 Rabbit pAb (APR25193N)
APR21193N-01	C12orf10 Rabbit pAb (APR21193N)
APR20893N-01	MRI1 Rabbit pAb (APR20893N)
APR20793N-01	JAG2 Rabbit pAb (APR20793N)
APR20393N-01	CD300LF Rabbit pAb (APR20393N)

Alternative Products

Catalog	Name
MBS8545097-01	EIF4G2 Rabbit pAb
GTR17868657	EIF4G2 Rabbit Polyclonal Antibody
C05848-20uL	EIF4G2/p97 Rabbit mAb
YLD2768-01	Rabbit anti-EIF4G2 Antibody
A21387	EIF4G2/p97 Rabbit pAb
314613-01	EIF4G2