Monoamine Oxidase A (MAOA) Rabbit pAb (APR20125N)

CAT:
882-APR20125N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Monoamine Oxidase A (MAOA) Rabbit pAb (APR20125N) - image 1

Monoamine Oxidase A (MAOA) Rabbit pAb (APR20125N)

  • Background:

    This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
  • Synonyms:

    MAOA; BRNRS; MAO-A
  • Gene ID:

    4128
  • UniProt:

    P21397
  • Cellular Locus:

    Cytoplasmic side, Mitochondrion outer membrane, Single-pass type IV membrane protein
  • Applications:

    WB (Mus musculus)
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 44kDa/59kDa Observed MW: 65kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Monoamine Oxidase A (MAOA) Rabbit pAb (APR20125N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4128
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P21397
  • AA Sequence:

    MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLN