Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb (APR20036N)

CAT:
882-APR20036N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb (APR20036N) - image 1

Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb (APR20036N)

  • Background:

    The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene.
  • Synonyms:

    EGLN2; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1
  • Gene ID:

    112398
  • UniProt:

    Q96KS0
  • Cellular Locus:

    Nucleus
  • Dilution:

    WB 1:500 - 1:2000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 40kDa/43kDa Observed MW: 43kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb (APR20036N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=112398
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q96KS0
  • AA Sequence:

    MSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGC