THOC3 Rabbit pAb (APR19829N)

CAT:
882-APR19829N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
THOC3 Rabbit pAb (APR19829N) - image 1

THOC3 Rabbit pAb (APR19829N)

  • Background :

    This gene encodes a component of the nuclear THO transcription elongation complex, which is part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. In humans, the transcription export complex is recruited to the 5'-end of messenger RNAs in a splicing- and cap-dependent manner. Studies of a related complex in mouse suggest that the metazoan transcription export complex is involved in cell differentiation and development. A pseudogene of this gene has been defined on chromosome 5.
  • Synonyms :

    THOC3; THO3; hTREX45
  • Gene ID :

    84321
  • UniProt :

    Q96J01
  • Cellular Locus :

    Nucleus, Nucleus speckle
  • Dilution :

    WB 1:500 - 1:2000
  • Form :

    Liquid
  • Buffer :

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight :

    Calculated MW: 36kDa/38kDa Observed MW: 39kDa
  • Storage Conditions :

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview :

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality THOC3 Rabbit pAb (APR19829N) .
  • Gene ID URL :

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84321
  • Uniprot URL :

    https://www.uniprot.org/uniprot/Q96J01
  • AA Sequence :

    MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide