CD3E Rabbit pAb (APR19043N)

CAT: 0882-APR19043N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR19043N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD3E Rabbit pAb (APR19043N) .

Synonyms

CD3E; IMD18; T3E; TCRE; CD3e molecule

Gene ID

916

UniProt

P07766

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 23kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=916

Uniprot URL

https://www.uniprot.org/uniprot/P07766

AA Sequence

MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

UniProtKB · P07766

T-cell surface glycoprotein CD3 epsilon chain

CD3E_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P07766
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: CD3E
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: A8K997

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Biological process

Adaptive immunityImmunity

Cellular component

Cell membraneMembrane

PTM

Disulfide bondPhosphoprotein

Domain

Immunoglobulin domainSignalTransmembraneTransmembrane helix

Molecular function

Receptor

Related Products

Catalog	Name
APR19045N-01	CD3E Antigen Rabbit pAb (APR19045N)
APR23777N-01	CD3E Rabbit pAb (APR23777N)
APR19009N-01	CD3D Rabbit pAb (APR19009N)
APR19743N-01	ACTL7B Rabbit pAb (APR19743N)
APR19643N-01	SPTB Rabbit pAb (APR19643N)
APR19443N-01	CNOT2 Rabbit pAb (APR19443N)
APR19343N-01	SLC10A1 Rabbit pAb (APR19343N)
APR19049N-01	CHAT Rabbit pAb (APR19049N)
APR18043N-01	CD300C Rabbit pAb (APR18043N)
APR19243N-01	TRPV3 Rabbit pAb (APR19243N)

Alternative Products

Catalog	Name
A19017-01	CD3E Rabbit mAb
E47R4815	CD3E Rabbit pAb
GTR18216740-01	Rabbit CD3E Antibody
GTR17875034	CD3E Rabbit Polyclonal Antibody
A12415-01	CD3E Antigen Rabbit pAb
A24879	Human CD3E Rabbit pAb