CD59 Rabbit pAb (APR19042N)

CAT: 0882-APR19042N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR19042N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD59 Rabbit pAb (APR19042N) .

Synonyms

CD59; 16.3A5; 1F5; EJ16; EJ30; EL32; G344; HRF-20; HRF20; MAC-IP; MACIF; MEM43; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20

Gene ID

966

UniProt

P13987

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor, Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=966

Uniprot URL

https://www.uniprot.org/uniprot/P13987

AA Sequence

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

UniProtKB · P13987

CD59 glycoprotein

CD59_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P13987
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: CD59
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: E9PR17

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Cellular component

Cell membraneMembraneSecreted

Disease

Disease variantHereditary hemolytic anemia

PTM

Disulfide bondGlycationGlycoproteinGPI-anchorLipoprotein

Domain

Signal

Related Products

Catalog	Name
APR23415N-01	CD59 Rabbit pAb (APR23415N)
APR19642N-01	SORL1 Rabbit pAb (APR19642N)
APR19542N-01	SRP14 Rabbit pAb (APR19542N)
APR19072N-01	HEXA Rabbit pAb (APR19072N)
APR19049N-01	CHAT Rabbit pAb (APR19049N)
APR19032N-01	Fas Rabbit pAb (APR19032N)
APR19012N-01	F2 Rabbit pAb (APR19012N)
APR19002N-01	AICDA Rabbit pAb (APR19002N)
APR29042N-01	CDKN1A Rabbit pAb (APR29042N)
APR19142N-01	SULT1A1 Rabbit pAb (APR19142N)

Alternative Products

Catalog	Name
MBS1241933-01	Recombinant Rabbit CD59 glycoprotein (CD59)
abx068728-01	Rabbit CD59 Glycoprotein (CD59) Protein
ELI-06798Ra	Rabbit CD59 glycoprotein,CD59 ELISA KIT
GTR10390517	Rabbit CD59 glycoprotein (CD59) ELISA kit
GTR17689091	CD59 glycoprotein CD59 Rabbit Polyclonal Antibody
C2375	CD59 Glycoprotein (CD59) Rabbit ELISA Kit
MBS8540126-01	CD59 Rabbit pAb
MBS435198-01	CD59 Rabbit mAb