ACP1 Rabbit pAb (APR19020N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ACP1 Rabbit pAb (APR19020N)
Background:
The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.Synonyms:
ACP1; HAAP; LMW-PTP; LMWPTPGene ID:
52UniProt:
P24666Cellular Locus:
CytoplasmDilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:100Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 12kDa/14kDa/17kDa/18kDa Observed MW: 18kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ACP1 Rabbit pAb (APR19020N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=52Uniprot URL:
https://www.uniprot.org/uniprot/P24666AA Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
