BST2 Rabbit pAb (APR18960N)

• Background:

  Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.

• Synonyms:

  BST2; CD317; TETHERIN

• Gene ID:

  684

• UniProt:

  Q10589

• Cellular Locus:

  Apical cell membrane, Cell membrane, Cytoplasm, GPI-anchor, Golgi apparatus, Late endosome, Lipid-anchor, Membrane raft, Single-pass type II membrane protein, trans-Golgi network

• Applications:

  WB (Mus musculus)

• Dilution:

  WB 1:500 - 1:2000 IF 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 18kDa/19kDa Observed MW: 35-40kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BST2 Rabbit pAb (APR18960N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=684

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q10589

• AA Sequence:

  NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS