IPO9 Rabbit pAb (APR18900N)
CAT:
882-APR18900N-01
Size:
50 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


IPO9 Rabbit pAb (APR18900N)
Background:
Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates the nuclear import of RPS7, RPL18A, RPL6, histone H2A, histone H2B and histone. Prevents the cytoplasmic aggregation of RPS7 and RPL18A by shielding exposed basic domains. Mediates the nuclear import of actin (By similarity.Synonyms:
IPO9; Imp9Gene ID:
55705UniProt:
Q96P70Cellular Locus:
Cytoplasm, NucleusDilution:
WB 1:500 - 1:2000 IF 1:50 - 1:100Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 115kDa Observed MW: 116kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IPO9 Rabbit pAb (APR18900N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55705Uniprot URL:
https://www.uniprot.org/uniprot/Q96P70AA Sequence:
LPGPTGKPALEFVMAEWTSRQHLFYGQYEGKVSSVALCKLLQHGINADDKRLQDIRVKGEEIYSMDEGIRTRSKSAKNPERWTNIPLLVKILKLIINELSNVMEANAARQATPAEWSQDDSNDMWEDQEEEEEEEEDGLAGQLLSDILATSKYEEDYYEDDEEDDPDALKDPLYQIDLQAYLTDFLCQFAQQPCYIMFSGHLNDNERRVLQTIGI