INADL Rabbit pAb (APR18760N)
CAT:
882-APR18760N-01
Size:
50 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


INADL Rabbit pAb (APR18760N)
Background:
This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.Synonyms:
PATJ; Cipp; INADL; InaD-like; hINADLGene ID:
10207UniProt:
Q8NI35Cellular Locus:
Apical cell membrane, Cell junction, Cell membrane, Cytoplasm, Peripheral membrane protein, perinuclear region, tight junctionApplications:
WB (Homo sapiens)Dilution:
WB 1:500 - 1:2000Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 125kDa/167kDa/170kDa/173kDa/196kDa Observed MW: 170kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality INADL Rabbit pAb (APR18760N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10207Uniprot URL:
https://www.uniprot.org/uniprot/Q8NI35AA Sequence:
MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSN