PGC1α Rabbit pAb (APR18696N)

CAT:
882-APR18696N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PGC1α Rabbit pAb (APR18696N) - image 1

PGC1α Rabbit pAb (APR18696N)

  • Background:

    The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs) . It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.
  • Synonyms:

    PPARGC1A; LEM6; PGC-1 (alpha) ; PGC-1alpha; PGC-1v; PGC1; PGC1A; PPARGC1; PPARG coactivator 1 alpha; PGC1 alpha
  • Gene ID:

    10891
  • UniProt:

    Q9UBK2
  • Cellular Locus:

    Cytoplasm, Nucleus, PML body
  • Applications:

    WB (Mus musculus, Rattus norvegicus) IHC (Mus musculus) IF (Mus musculus)
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 14kDa/30kDa/31kDa/33kDa/77kDa/89kDa/91kDa Observed MW: 91KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PGC1α Rabbit pAb (APR18695N1) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10891
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9UBK2
  • AA Sequence:

    FGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR