CD8A Rabbit pAb (APR18663N)

CAT: 0882-APR18663N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR18663N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD8A Rabbit pAb (APR18661N6) .

Synonyms

CD8A; CD8; Leu2; MAL; p32

Gene ID

925

UniProt

P01732

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein

Applications

IHC (Mus musculus, Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/25kDa/30kDa Observed MW: 26KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=925

Uniprot URL

https://www.uniprot.org/uniprot/P01732

AA Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Related Products

Catalog	Name
APR18668N-01	CDC42 Rabbit pAb (APR18668N)
APR18636N-01	SFTPC Rabbit pAb (APR18636N)
APR18613N-01	AKAP7 Rabbit pAb (APR18613N)
APR18603N-01	SHARPIN Rabbit pAb (APR18603N)
APR18563N-01	SMPD2 Rabbit pAb (APR18563N)
APR28663N-01	APOA4 Rabbit pAb (APR28663N)
APR18763N-01	DTNA Rabbit pAb (APR18763N)
APR18683N-01	SIX1 Rabbit pAb (APR18683N)
APR18673N-01	STAT3 Rabbit pAb (APR18673N)
APR18666N-01	Nestin Rabbit pAb (APR18666N)

Alternative Products

Catalog	Name
UB-GEN-13898	CD8A rabbit pAb
A23305	CD8A Rabbit PolymAb®
A23953	CD8A Rabbit mAb
MBS9147926-01	CD8A Rabbit PolymAb
BT-AP01311-01	CD8A Rabbit Polyclonal Antibody
1107NF-V6059	CD8a

CD8A Rabbit pAb (APR18663N)

Related Products

Alternative Products

Popular Products