[KO Validated] β-Catenin Rabbit pAb (APR18419N)

• Background:

  The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs) . AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.

• Synonyms:

  CTNNB; MRD19; armadillo; beta Catenin; CTNNB1

• Gene ID:

  1499

• UniProt:

  P35222

• Cellular Locus:

  Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole

• Applications:

  IHC (Human chronic myeloid leukemia cells) IF (Human chronic myeloid leukemia cells, ADSCs) WB (Rattus norvegicus)

• Dilution:

  WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 9kDa/85kDa Observed MW: 100KDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] β-Catenin Rabbit pAb (APR18418N3) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1499

• Uniprot URL:

  https://www.uniprot.org/uniprot/P35222

• AA Sequence:

  GVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPV