[KO Validated] LC3B Rabbit pAb (APR18401N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] LC3B Rabbit pAb (APR18401N) - image 1](/gentaur-product-1.webp)
![[KO Validated] LC3B Rabbit pAb (APR18401N) - image 1](/gentaur-product-1.webp)
[KO Validated] LC3B Rabbit pAb (APR18401N)
Background:
The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.Synonyms:
LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3; MAP1LC3B; LC3A/LC3BGene ID:
81631UniProt:
Q9GZQ8Cellular Locus:
Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeletonApplications:
WB (Rattus norvegicus, Homo sapiens)Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 14kDa Observed MW: 14KDa/16KDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] LC3B Rabbit pAb (APR18400N0) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81631Uniprot URL:
https://www.uniprot.org/uniprot/Q9GZQ8AA Sequence:
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYE
