[KO Validated] HP1 alpha/CBX5 Rabbit pAb (APR18313N)

CAT:
882-APR18313N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
[KO Validated] HP1 alpha/CBX5 Rabbit pAb (APR18313N) - image 1

[KO Validated] HP1 alpha/CBX5 Rabbit pAb (APR18313N)

  • Background:

    This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified.
  • Synonyms:

    CBX5; HEL25; HP1; HP1A
  • Gene ID:

    23468
  • UniProt:

    P45973
  • Cellular Locus:

    Chromosome, Nucleus, centromere
  • Applications:

    WB (Homo sapiens)
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:200 IP 1:50 - 1:200 ChIP 1:20 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 22kDa Observed MW: 22kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] HP1 alpha/CBX5 Rabbit pAb (APR18313N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23468
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P45973
  • AA Sequence:

    MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS