[KO Validated] RhoC Rabbit pAb (APR18221N)

CAT:
882-APR18221N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
[KO Validated] RhoC Rabbit pAb (APR18221N) - image 1

[KO Validated] RhoC Rabbit pAb (APR18221N)

  • Background:

    This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
  • Synonyms:

    RHOC; ARH9; ARHC; H9; RHOH9
  • Gene ID:

    389
  • UniProt:

    P08134
  • Cellular Locus:

    Cell membrane, Cleavage furrow, Cytoplasmic side, Lipid-anchor
  • Applications:

    WB (Homo sapiens, Mus musculus)
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 22kDa Observed MW: 22KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] RhoC Rabbit pAb (APR18221N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=389
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P08134
  • AA Sequence:

    MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL