Α-Smooth Muscle Actin (ACTA2) Rabbit pAb (APR17738N)

• Background:

  The protein encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Defects in this gene cause aortic aneurysm familial thoracic type 6. Multiple alternatively spliced variants, encoding the same protein, have been identified.

• Synonyms:

  AAT6; ACTSA; MYMY5; ACTA2; actin

• Gene ID:

  59

• UniProt:

  P62736

• Cellular Locus:

  Cytoplasm, cytoskeleton

• Applications:

  WB (Mus musculus, Rattus norvegicus, Homo sapiens) IF (Mus musculus, Rattus norvegicus) IHC (Mus musculus, Rattus norvegicus)

• Dilution:

  WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:100 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 42kDa Observed MW: 42KDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality α-Smooth Muscle Actin (ACTA2) Rabbit pAb (APR17738N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=59

• Uniprot URL:

  https://www.uniprot.org/uniprot/P62736

• AA Sequence:

  MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI