EAAT2/SLC1A2 Rabbit pAb (APR17582N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


EAAT2/SLC1A2 Rabbit pAb (APR17582N)
Background:
This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Improper regulation of this gene is thought to be associated with several neurological disorders. Alternatively spliced transcript variants of this gene have been identified.Synonyms:
SLC1A2; EAAT2; EIEE41; GLT-1; HBGTGene ID:
6506UniProt:
P43004Cellular Locus:
Membrane, Multi-pass membrane proteinApplications:
WB (Rattus norvegicus, Mus musculus)Dilution:
WB 1:500 - 1:5000 IHC 1:100 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 61kDa/62kDa Observed MW: 65kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EAAT2/SLC1A2 Rabbit pAb (APR17582N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6506Uniprot URL:
https://www.uniprot.org/uniprot/P43004AA Sequence:
HLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
