ACVR1C Rabbit pAb (APR17510N)

• Background:

  ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]) .[supplied by OMIM, Mar 2008]

• Synonyms:

  ACVR1C; ACVRLK7; ALK7

• Gene ID:

  130399

• UniProt:

  Q8NER5

• Cellular Locus:

  Membrane, Single-pass type I membrane protein

• Dilution:

  WB 1:500 - 1:2000 IHC 1:100 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 37kDa/46kDa/49kDa/54kDa Observed MW: 55KDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ACVR1C Rabbit pAb (APR17510N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=130399

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q8NER5

• AA Sequence:

  LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME