IGF1R Rabbit pAb (APR17364N)

CAT:
882-APR17364N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IGF1R Rabbit pAb (APR17364N) - image 1

IGF1R Rabbit pAb (APR17364N)

  • Background:

    This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
  • Synonyms:

    IGF1R; CD221; IGFIR; IGFR; JTK13
  • Gene ID:

    3480
  • UniProt:

    P08069
  • Cellular Locus:

    Cell membrane, Single-pass type I membrane protein
  • Applications:

    WB (Homo sapiens, Mus musculus) IF (Mus musculus)
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 154kDa Observed MW: 100KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IGF1R Rabbit pAb (APR17364N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3480
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P08069
  • AA Sequence:

    HNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAA