GORAB Antibody : HRP (OAAF08022-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


GORAB Antibody : HRP (OAAF08022-HRP)
Gene Aliases:
GO, NTKLBP1, SCYL1BP1Gene ID:
92344Swiss Prot:
Q5T7V8Host:
RabbitReactivity:
Human, Mouse, RatImmunogen:
The antiserum was produced against synthesized peptide derived from the N-terminal region of human GORAB.Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WB, ELISAPurification:
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.Concentration:
0.6-0.7 mg/mlFormat:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
44 kDaShipping Conditions:
Wet IceSpecificity:
GORAB Antibody detects endogenous levels of GORAB protein.NCBI Gene Symbol:
GORABNCBI GB Accession Number:
GORABHost or Source:
RabbitPeptide Sequence:
MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEP
