Retinoblastoma Antibody (Phospho-Ser249) : Biotin (OAAF07591-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Retinoblastoma Antibody (Phospho-Ser249) : Biotin (OAAF07591-Biotin)
Gene Aliases:
RB, pRb, OSRC, pp110, p105-Rb, PPP1R130, p110-RB1Gene ID:
5925Swiss Prot:
P06400Host:
RabbitReactivity:
Human, Mouse, RatImmunogen:
The antiserum was produced against synthesized peptide derived from human Retinoblastoma around the phosphorylation site of Ser249.Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
IF, ELISAPurification:
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.Concentration:
1 mg/mlFormat:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
106 kDaShipping Conditions:
Wet IceSpecificity:
Retinoblastoma (Phospho-Ser249) Antibody detects endogenous levels of Retinoblastoma only when phosphorylated at Ser249.NCBI Gene Symbol:
RB1NCBI GB Accession Number:
RB1Host or Source:
RabbitPeptide Sequence:
CVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLEND
