CASP4 Antibody - N-terminal region : Biotin (ARP75977_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CASP4 Antibody - N-terminal region : Biotin (ARP75977_P050-Biotin)
Gene Aliases:
TX, Mih1, ICH-2, Mih1/TX, ICEREL-II, ICE (rel) IIGene ID:
837Swiss Prot:
P49662Host:
RabbitReactivity:
HumanImmunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CASP4Target:
This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity purifiedConcentration:
0.5 mg/mlFormat:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
41kDaShipping Conditions:
Wet IceProtein Length:
377NCBI Gene Symbol:
CASP4NCBI GB Accession Number:
CASP4Host or Source:
RabbitPeptide Sequence:
ADSMQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALK
