DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)
Gene Aliases:
RCL, C6orf108, dJ330M21.3Gene ID:
10591Swiss Prot:
O43598Host:
RabbitReactivity:
HumanImmunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNPH1Target:
This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described.Partner Proteins:
DNPH1; UBC; PILRA; UBR1; ZNF593; SSU72; DSTN; UBA1; PRDX1; POT1; TERF1Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity purifiedConcentration:
0.5 mg/mlFormat:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
19kDaShipping Conditions:
Wet IceProtein Length:
174NCBI Gene Symbol:
DNPH1NCBI GB Accession Number:
DNPH1Host or Source:
RabbitPeptide Sequence:
GRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPT
