VPS35 Antibody - C-terminal region : HRP (ARP74343_P050-HRP)

• Gene Aliases:

  MEM3, PARK17

• Gene ID:

  55737

• Swiss Prot:

  Q96QK1

• Accession Number:

  NP_060676.2

• Host:

  Rabbit

• Reactivity:

  Human

• Immunogen:

  The immunogen is a synthetic peptide directed towards the C-terminal region of Human VPS35

• Target:

  This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex.

• Clonality:

  Polyclonal

• Conjugation:

  HRP: Horseradish Peroxidase

• Type:

  Polyclonal Antibody

• Applications:

  WB

• Purification:

  Affinity purified

• Concentration:

  0.5 mg/ml

• Format:

  Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

• Reconstitution:

  All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

• Molecular Weight:

  87 kDa

• Shipping Conditions:

  Wet Ice

• Protein Length:

  796

• NCBI Gene Symbol:

  VPS35

• NCBI GB Accession Number:

  VPS35

• Host or Source:

  Rabbit

• Peptide Sequence:

  YNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIH