AIPL1 Antibody - C-terminal region : HRP (ARP72738_P050-HRP)

CAT:
247-ARP72738_P050-HRP
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
AIPL1 Antibody - C-terminal region : HRP (ARP72738_P050-HRP) - image 1

AIPL1 Antibody - C-terminal region : HRP (ARP72738_P050-HRP)

  • Gene Name:

    Aryl hydrocarbon receptor interacting protein-like 1
  • Gene Aliases:

    LCA4, AIPL2
  • Gene ID:

    23746
  • Swiss Prot:

    F1T0C4
  • Accession Number:

    NP_001272332.1
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat, Cow, Horse, Pig, Rabbit
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the C-terminal region of human AIPL1
  • Target:

    Leber congenital amaurosis (LCA) is the most severe inherited retinopathy with the earliest age of onset and accounts for at least 5% of all inherited retinal diseases. Affected individuals are diagnosed at birth or in the first few months of life with nystagmus, severely impaired vision or blindness and an abnormal or flat electroretinogram. The photoreceptor/pineal-expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, is located within the LCA4 candidate region. The encoded protein contains three tetratricopeptide motifs, consistent with chaperone or nuclear transport activity. Mutations in this gene may cause approximately 20% of recessive LCA. Alternative splicing results in multiple transcript variants.
  • Clonality:

    Polyclonal
  • Conjugation:

    HRP: Horseradish Peroxidase
  • Type:

    Polyclonal Antibody
  • Applications:

    WB
  • Purification:

    Affinity Purified
  • Concentration:

    0.5 mg/ml
  • Homology:

    Cow: 79%; Horse: 86%; Human: 100%; Mouse: 77%; Pig: 86%; Rabbit: 79%; Rat: 77%
  • Format:

    Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
  • Reconstitution:

    All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
  • Molecular Weight:

    29kDa
  • Shipping Conditions:

    Wet Ice
  • Protein Length:

    270
  • NCBI Gene Symbol:

    AIPL1
  • NCBI GB Accession Number:

    AIPL1
  • Host or Source:

    Rabbit
  • Protein Name:

    Aryl-hydrocarbon-interacting protein-like 1
  • Nucleotide Accession Number:

    NM_001285403.2
  • Peptide Sequence:

    DLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEG