CCNJL Antibody - C-terminal region : FITC (ARP68868_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CCNJL Antibody - C-terminal region : FITC (ARP68868_P050-FITC)
Gene ID:
79616Accession Number:
NP_078841Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, HorseImmunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCNJLTarget:
The function of this protein remains unknown.Partner Proteins:
KRTAP26-1; KRTAP10-8; C1orf94; TRAF2; REL; AESClonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
40kDaShipping Conditions:
Wet IceProtein Length:
365NCBI Gene Symbol:
CCNJLNCBI GB Accession Number:
CCNJLHost or Source:
RabbitNucleotide Accession Number:
NM_024565Peptide Sequence:
GQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQ
