VCX3A Antibody - N-terminal region : HRP (ARP67903_P050-HRP)

CAT:
247-ARP67903_P050-HRP
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
VCX3A Antibody - N-terminal region : HRP (ARP67903_P050-HRP) - image 1

VCX3A Antibody - N-terminal region : HRP (ARP67903_P050-HRP)

  • Gene Aliases:

    VCX3, VCXA, VCX-A, VCX8R, VCX-8r
  • Gene ID:

    51481
  • Swiss Prot:

    Q9NNX9
  • Accession Number:

    NP_057463
  • Host:

    Rabbit
  • Reactivity:

    Human, Horse
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the N-terminal region of Human VCX3A
  • Target:

    This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit.
  • Clonality:

    Polyclonal
  • Conjugation:

    HRP: Horseradish Peroxidase
  • Type:

    Polyclonal Antibody
  • Applications:

    WB
  • Purification:

    Affinity Purified
  • Concentration:

    0.5 mg/ml
  • Homology:

    Horse: 100%; Human: 100%
  • Format:

    Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
  • Reconstitution:

    All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
  • Molecular Weight:

    20kDa
  • Shipping Conditions:

    Wet Ice
  • Protein Length:

    186
  • NCBI Gene Symbol:

    VCX3A
  • NCBI GB Accession Number:

    VCX3A
  • Host or Source:

    Rabbit
  • Protein Name:

    Variable charge X-linked protein 3
  • Nucleotide Accession Number:

    NM_016379
  • Peptide Sequence:

    KKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHEL