VCX3A Antibody - N-terminal region : HRP (ARP67903_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


VCX3A Antibody - N-terminal region : HRP (ARP67903_P050-HRP)
Gene Aliases:
VCX3, VCXA, VCX-A, VCX8R, VCX-8rGene ID:
51481Swiss Prot:
Q9NNX9Accession Number:
NP_057463Host:
RabbitReactivity:
Human, HorseImmunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human VCX3ATarget:
This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit.Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Horse: 100%; Human: 100%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
20kDaShipping Conditions:
Wet IceProtein Length:
186NCBI Gene Symbol:
VCX3ANCBI GB Accession Number:
VCX3AHost or Source:
RabbitProtein Name:
Variable charge X-linked protein 3Nucleotide Accession Number:
NM_016379Peptide Sequence:
KKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHEL
